PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g13041.2.p
Common NameBRADI_5g13041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 404aa    MW: 43796 Da    PI: 5.943
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g13041.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-1766113148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg WT+eEd +l   ++q G+++W++I++  g+ R++k+c++rw +yl
  Bradi5g13041.2.p  66 RGQWTPEEDNKLRSHIAQNGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 113
                       89********************************************97 PP

2Myb_DNA-binding452.6e-14120162246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g +T  E++ +++++   G++ W+ Ia+ ++ gRt++++k++w++
  Bradi5g13041.2.p 120 GEFTDAEEQTIIKLHSVVGNR-WSVIAAQLP-GRTDNDVKNHWNT 162
                       789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-2457116IPR009057Homeodomain-like
PROSITE profilePS5129426.34861117IPR017930Myb domain
SuperFamilySSF466891.35E-2864160IPR009057Homeodomain-like
SMARTSM007174.5E-1365115IPR001005SANT/Myb domain
PfamPF002498.3E-1666113IPR001005SANT/Myb domain
CDDcd001677.75E-1269113No hitNo description
Gene3DG3DSA:1.10.10.602.4E-24117168IPR009057Homeodomain-like
SMARTSM007172.8E-14118166IPR001005SANT/Myb domain
PROSITE profilePS5129420.197118168IPR017930Myb domain
PfamPF002497.6E-13120162IPR001005SANT/Myb domain
CDDcd001671.64E-10121164No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MQIQRQSISS TGKYTRNRKI VAARPPSDVR TYVPEEESAA TEGAESGGAG IDMGRIPCCE  60
KESVKRGQWT PEEDNKLRSH IAQNGTRNWR LIPKNAGLQR CGKSCRLRWT NYLRPDLKHG  120
EFTDAEEQTI IKLHSVVGNR WSVIAAQLPG RTDNDVKNHW NTKLKKKLSG MGIDPVTHKS  180
FSHLMAEIAT TLAPPQVAHL AEAALGCFKD EMLHLLTKKR PTDFPSPAVP DMSAMAMGAP  240
CFPAQPQQQQ AQDDTIERIK MGLSRAIMSE PAAAAEDDKP WPQPGDMSEM YAAFNNATPH  300
APEFRYEGTA AAPGYLLGGD GGDQGTSMWS SHHSMYSGSS GTEGACRPAL QEKGNDSVGS  360
SGGDDEAEED CKESGKGGSD ISGLFGSDCV LWDLPDELTN HMV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28661687108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0342380.0BT034238.1 Zea mays full-length cDNA clone ZM_BFc0028K07 mRNA, complete cds.
GenBankBT0394220.0BT039422.1 Zea mays full-length cDNA clone ZM_BFc0012M19 mRNA, complete cds.
GenBankBT0406700.0BT040670.1 Zea mays full-length cDNA clone ZM_BFc0113I05 mRNA, complete cds.
GenBankBT0432400.0BT043240.1 Zea mays full-length cDNA clone ZM_BFc0129J22 mRNA, complete cds.
GenBankBT0549880.0BT054988.1 Zea mays full-length cDNA clone ZM_BFc0168O09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579943.10.0PREDICTED: myb-related protein Zm38
SwissprotQ7XQN10.0MYB80_ORYSJ; Transcription factor MYB80
TrEMBLA0A0Q3E5T80.0A0A0Q3E5T8_BRADI; Uncharacterized protein
STRINGBRADI5G13041.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108673339
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-111myb domain protein 103